u follow ME.. i follow u ^_*

meletopp klee KLIK iklan bwahh nie...

Friday, May 6, 2011

Semua panjang.

Salam readers... tajuk entri ialah semua panjang..... jangan fikir yang bukan-bukan pulak.
aku nak cerita pasal nama terpanjang, e-mail terpanjang, nama perkampungan terpanjang dan macam lagi la... kalau korang nak tahu check out dekat bawah nie....

1.Nama Manusia Terpanjang Di Dunia

'Autumn Sullivan Corbett Fitzsimmons Jeffries Hart Burns Johnson Willard Dempsey Tunney Schmeling Sharkey Carnera Baer Braddock Louis Charles Walcott Marciano Patterson Johansson Liston Clay Frazier Foreman Brown'
.Merupakan nama seorang kanak-kanak di British.Namanya yang terdiri dari 27 kata nama yang diambil dari 25 nama Petinju Top dari seluruh dunia dan 2 bakinya yang lain adalah nama depan dan nama keluarga.

2.Nama Perkampungan Terpanjang Di Dunia

'Llanfairpwllgwyngllgogerychwyrndrobwllllantysiliogogogoch'
Merupakan nama sebuah perkampungan di Pulau Anglesey di Wales,Britania Raya.Perkampungan ini tercatat dalam Guiness Book of Record sebagai tempat dengan nama kampung terpanjang di Britania.

3.Nama Bukit Terpanjang Di Dunia
'Taumatawhakatangihangakoauauotamateaturipukakapikimaungahoronukupokaiwhenuakitanatahu'.
Adalah nama sebuah Bukit di porangahau,di selatan Waipukurau Hawke's Bay,selandia Baru.Nama pendek bukit tersebut boleh dipanggil 'Taumata'.

4.Nama Tempat Terpanjang Di Dunia
'Krungthepmahankonbowornratanakosinmahintarayudyyayamahhadiloponoparatanarajthaniburiromudomrajniweshasatarnamornpimarnavatarsatitsakattiyavisanukampharasit'
.Merupakan nama sebuah tempat di Thailand.Sumber:WikiPedia.

5.Nama Domain Terpanjang di Dunia
'http://www.llanfairpwllgwyngyllgoger...gogogoch.co.uk'.Merupakan nama sebuah website untuk mempromosikan sebuah tempat di anglesey,Gwyned-Britain.nama tempat tersebut sama dengan nama websitenya.

6.Nama E-mail Terpanjang Di Dunia
'yourname@abcdefghijklmnopqrstuvwxyza...bcdefghijk.com'.Nama yang sangat panjang untuk sebuah alamat email.Nama website untuk email tersebut 'http://www.abcdefghijklmnopqrstuvwxyza...bcdefghijk.com'.

7.Nama Album Terpanjang Di Dunia

'He Who Dwells in the Secret Place of the Most High Shall Abide Under the Shadow of the Almighty'
.adalah nama sebuah album dari bekas penyanyi Sin Ad O' Connor'.


sumber: http://www.fcukz.co.cc/2010/04/pelbagai-nama-terpanjang-di-dunia.html#ixzz1LdkxxD97

3 comments:

  1. aku ingat nama aku sorang je yg panjang dalam dunia ni. haha

    ReplyDelete
  2. Menarik postingannya sobat, tambah lagi yang semua panjang.

    ReplyDelete
  3. gile dasat lahh . =]

    http://hanieputeri.blogspot.com/2011/05/weight-emergency-and-iphone-4.html

    ReplyDelete