u follow ME.. i follow u ^_*

meletopp klee KLIK iklan bwahh nie...

Sunday, May 22, 2011

aku dan Bruno Mars

Bruno Mars picture 1
korang kenal tak siapa itu Bruno Mars.. mesti kenal kan siapa tak kenal tue tak tau la ank cakap apa kan, 
aku tak dapat la nak tolongkan.. aku cuma boleh sediakan button click disini .. hahaha nak tahu lebih tekan lah...
aku cuma nak kongsikan semua koleksi lagu dia yang aku sangat suka.. bak kata orang layan laa..
kalau tak silap aku bruno mars ada dekat 35 buah lagu...tapi tak semua aku dengar la kan.. banyak tue.  
nie aku nak kongsi antara lagu dia yang aku memang layan laa..
banyak lagi lah kalau aku nak share dekat sini... apa-apa pon memang best la semua lagu dia nie...
korang pulak macam mana minat kew??

cuti punya pasal!

Salam readers...fuhh...fuhh... banyak nya habuk.. yekk laaa. sah dekat seminggu tak update blog kan.. nie kes cuti punya pasal....
mana tidak nya dekat seminggu aku tak buka blog , facebook dengan twitter.. fuhhh .....memangg rasa nak pecah kepala sebab tak buka benda-benda nie...
ini adalah kerana aku nak catch up balik semua cerita terkini dekat TV...hahaha ye la banyakk tertinggal kot macam maharajalawak dan akademi fantasia... iss memang wajid aku tonton AF tue setiap tahun tak pernah miss dari AF pertama lagi... 
kalu dilihat dari notifications aku dekat FB memangg bertimbum-timbun...
nak clear click dekat gambar tue.
tapi twitter aku tak ada ;la sebanyak macam FB kan..hahah ..
sempena musim cuti nie mamang banyak la aktiviti nya antara yang telah dirancang gathering.. and kerja "kot"...
apa-apa pun selamat cuti pada korang semua...and selamat mendapat result terbaik untuk semester nie...

Thursday, May 12, 2011

faizal tahir berduet dengan siti nurhaliza?

Tajuk entri macam best je kan... hahaha... aku tau mesti dah lama peminat Faizal Tahir dan Siti Nurhaliza tunggu untuk diorang berduetkan.. tapi belum ada rezeki lagi.. cuma Siti jadi penyanyi latar untuk lagu baru Faizal Tahir 
pernah tak korang dengar lagu KARMA  dari Faizal Tahir.. perasan tak sewaktu korus tue ada suara permpuan yang jerit
 "heiiii ...heiii..."
sebenarnya itulah suara Siti.. menurut pendapat Faizal.. suara Siti yang sikIt tue membuat ia lebih mahal...
korang try layan lagu kat karma tue dekat bawah nie...
perasan tak... kalau tak perasan lagi korang 
ulanglah
video tue yek....

review filem KONGSI

Alhamdulillah.. lastly, boleh buka juga aku punya blog nie.. tekejut juga aku sebab blog aku tak boleh buka tadi.. nasib ada yang senasib dengan aku jugak.. 
okk back to the main topic..
 tengahari tadi aku dengan geng aku telah pergi tengok filem kongsi.. fuhh tengok dari poster dengan trailer memang mantop..seat dekat panggung wayang pun agak penuh.
tapi.. aku punya pandangan berubah apabila selesai tengok cerita tue.. memang tak seperti yang dijangkakan...
okk boleh la cakap aksi ok... ada lawak (sebak sam try untuk cakap kelantan thai) tapi dia punya jalan cerita tak berapa nak best.. keluar je panggung ramai aku dengar yang mengeluh.. 
korang layan dulu trailer dekat bawah nie..
.
.
.
apa-apapun pendapat setiap orang berbezakan.. mata pun lain-lain.. itu just pendapat aku sebagai penonton.. apa-apa korang pergilah tengok sendiri... 
selamat menonton

Wednesday, May 11, 2011

selamat hari jadi pada NURSE

Salam readers, pada semua student mesti korang rasa excited kan nak balik cuti semester nie.ye la cuti dekat empat bulan tue... opss.. tapi bukan tue aku nak story kali nie...korang tahu tak hari ini hari apa.
12/5/2011
HARI INI IALAH HARI NURSE SEDUNIA....

aku nak ucapkan selamat hari nurse sedunia.. terima kasih memberi bantuan pada kami nie. masyarakat Malaysia...sebab ramai juga la kawan aku yang jadi nurse.. pada korang jangan lupa jadi nurse yang desenangi masyarakat...
Wan norul Faezah
kerja baik2 yek...

Tuesday, May 10, 2011

Buku terkecil di Dunia

Salam readers... apa khabar oranng kampung (semangat nak balik).. hari nie aku nak story dekat korang pasal buku... opsss.. kejap, bukan b

kerusi unik lagi pelik!

Salam readers... cuba korang tengok kerusi yang sedang korang duduk.... perhatikan bentuknya... unik tak.. kadang2 kerusi tue pelik tapi kita tak tahu..korang tengok pulak kerusi dekat bawah nie.. pelik tak??
.
.
.
Schair14 Kerusi paling unik dan kreatif
chair13 Kerusi paling unik dan kreatif
chair09 Kerusi paling unik dan kreatif
chair12 Kerusi paling unik dan kreatif
chair08 Kerusi paling unik dan kreatif
chair06 Kerusi paling unik dan kreatif
chair05 Kerusi paling unik dan kreatif
chair04 Kerusi paling unik dan kreatif
chair15 Kerusi paling unik dan kreatif
amacam... 
pelik tak..hahaha siapa nak beli boleh la order dekat  kedi-kedai berhampiran..hihih

Saturday, May 7, 2011

10 Kasut TERMAHAL di dunia

Salam readers, ada okay hari nie... nie aku nak cerita pasal kasut pulak.. aku nak tanya berapa ratus atau ribukah kasut NIKE dan GUCCI korang.... ada semahal kasut dekat bawah nie tak?? tapi aku beli kasut dekat pasar malam je..hahahah


#10: Kasut Nike Dilapisi Berlian
Harga: US$ 50 ribu 
 #9: Kasut Milik Raja India
Harga: US$ 160 ribu
 #8: Stiletto Diamond Dream Stuart Weitzman
Harga : US$ 500 ribu
 #7: Kasut Wanita 'The Wizard of Oz'
Harga: US$ 666 ribu
 #6: Retro Rose Stuart Weitzman
Harga: US$ 1 juta 
 #5: Stiletto Guild Platinum Stuart Weitzman
Harga: US$ 1,09 juta
 #4: Stiletto Rubi Stuart Weitzman
Harga : US$ 1,6 juta
 #3: High Heels Tanzanite Stuart Weitzman
Harga: US$ 2 juta 
 #2: Kasut Wanita Cinderella Stuart Weitzman
Harga: US$ 2 juta 
#1: Stuart Weitzman’s Rita Hayworth Heels
Harga: US$3 juta

mampu tak korang nak beli kasut semahal dekat atas nie ??... kalu aku tunggu setahun pun belum tentu mampu kumpul duit nak beli kasut macam dekat atas nie..


sumber: http://www.fcukz.co.cc/2010/04/10-kasut-termahal-di-dunia.html#ixzz1Ljxh8eLr

Friday, May 6, 2011

Semua panjang.

Salam readers... tajuk entri ialah semua panjang..... jangan fikir yang bukan-bukan pulak.
aku nak cerita pasal nama terpanjang, e-mail terpanjang, nama perkampungan terpanjang dan macam lagi la... kalau korang nak tahu check out dekat bawah nie....

1.Nama Manusia Terpanjang Di Dunia

'Autumn Sullivan Corbett Fitzsimmons Jeffries Hart Burns Johnson Willard Dempsey Tunney Schmeling Sharkey Carnera Baer Braddock Louis Charles Walcott Marciano Patterson Johansson Liston Clay Frazier Foreman Brown'
.Merupakan nama seorang kanak-kanak di British.Namanya yang terdiri dari 27 kata nama yang diambil dari 25 nama Petinju Top dari seluruh dunia dan 2 bakinya yang lain adalah nama depan dan nama keluarga.

2.Nama Perkampungan Terpanjang Di Dunia

'Llanfairpwllgwyngllgogerychwyrndrobwllllantysiliogogogoch'
Merupakan nama sebuah perkampungan di Pulau Anglesey di Wales,Britania Raya.Perkampungan ini tercatat dalam Guiness Book of Record sebagai tempat dengan nama kampung terpanjang di Britania.

3.Nama Bukit Terpanjang Di Dunia
'Taumatawhakatangihangakoauauotamateaturipukakapikimaungahoronukupokaiwhenuakitanatahu'.
Adalah nama sebuah Bukit di porangahau,di selatan Waipukurau Hawke's Bay,selandia Baru.Nama pendek bukit tersebut boleh dipanggil 'Taumata'.

4.Nama Tempat Terpanjang Di Dunia
'Krungthepmahankonbowornratanakosinmahintarayudyyayamahhadiloponoparatanarajthaniburiromudomrajniweshasatarnamornpimarnavatarsatitsakattiyavisanukampharasit'
.Merupakan nama sebuah tempat di Thailand.Sumber:WikiPedia.

5.Nama Domain Terpanjang di Dunia
'http://www.llanfairpwllgwyngyllgoger...gogogoch.co.uk'.Merupakan nama sebuah website untuk mempromosikan sebuah tempat di anglesey,Gwyned-Britain.nama tempat tersebut sama dengan nama websitenya.

6.Nama E-mail Terpanjang Di Dunia
'yourname@abcdefghijklmnopqrstuvwxyza...bcdefghijk.com'.Nama yang sangat panjang untuk sebuah alamat email.Nama website untuk email tersebut 'http://www.abcdefghijklmnopqrstuvwxyza...bcdefghijk.com'.

7.Nama Album Terpanjang Di Dunia

'He Who Dwells in the Secret Place of the Most High Shall Abide Under the Shadow of the Almighty'
.adalah nama sebuah album dari bekas penyanyi Sin Ad O' Connor'.


sumber: http://www.fcukz.co.cc/2010/04/pelbagai-nama-terpanjang-di-dunia.html#ixzz1LdkxxD97

review filem THOR

Salam readers.. korang dah pergi tengok THOR ke belum.... wauu memang speechless....tapi mesti ada yang dah pergi tengok kan.. sebab yang 3D dah keluar 7 hari lepas kot,.... tapi sebab tak cukup bajet .. kiteorang terpaksa lah tunggu yang biasa punya keluar..
cerita dia menggisahkan seorang anak tuhan yang melanggar arahan ayah dia.. dah telah dicampak ke bumi... jeng.. jeng..jengg  nak tau lagi tengok la sendiri yekk....hahaha..nie aku cuma boleh bagi korang tengok trailer je....
tapi aku cadang dekat korang tengok dekat MBO.. memangg best sound effect dia.. tapi mahal la sikit kann...apa-apa pon 5 star utk cerita  Kenneth Branagh nie

Thursday, May 5, 2011

Bulu mata pelik.

Kali nie aku bercerita khas utk lelaki wanita..haahah aku bukan la pakar sakit puan.. tapi just nak share pasal bulu mata ...hahaha... nie dia aku nak cadangkan untuk para wanita mencuba bulu mata palsu dekat bawahn nie....

bulu mata kaki lalat
 

bulu mata LED

bulu mata kertas



bulu mata bendera



bulu mata Neo Reflector



bulu mata bunga



bulu mata berlian


berani tak korang nak TRY??
so siapa berminat cari la dekat kedai yek...


* p/s pada lelaki yang nak kasi awek korang gempak beli la tuk si dia

Iklan termahal di DUNIA

salam readers... ok tak hari ini... kali ni aku nak kasi korang layan video pulak.. pada pendapat korang iklan mana paling mahal pernah anda tengok? (kalau tahu la) 
nie dia aku nak tunjuk dekat korang satu iklan yang memang mahal gila!!...
iklan nie berharga 6.2 million dan memgambil masa lebih kurang 6 bulan untuk disiapkan...
nak tahu sebab apa iklan nie mahal... sebenarnya iklan nie tidak menggunakan sebarangan special effect atau edit melalui komputer mahupun.. wauuu kagum tak???
nie korang try tengok keunikan iklan nie....
amacam.. 
terbaik tak??
nie ialah iklan pasal kereta Honda..

Wednesday, May 4, 2011

Haiwan pun nak cantik

apa khabar readers, hari nie aku nak cerita pasal haiwan pulak. asik pasal manusia je ka??
sepanjang hidup korang pernah tak  tengok binatang berwarna.. ala lebih kurang macam binatang dalam kartun tue la... ada kambing warna pink la, anjing warna biru dan macam-macam la..haaaa nie aku nak tunjuk dekat korang... .
.
.
.




cam mana ada rasa nak buat dekat binatang peliharaan dekat rumah... hahaha aku tengok dah macam Doraemon pon ada kan..

Tebalnya!!

sempena musim final nie , mesti korang dah naik peningkan tengok buku, tapi korang rasa buku korang ada tak buku setebal dekat bawah nie tak.. kalau aku lah baca buku setebal macam nie.. mahu menangis aku....
.
.
.




amacam.?? 
korang rasa boleh tak baca buku setebal nie... kalau aku mungkin tunggu setahun pun belum tentu habis baca..

Ayam gedik?

fuhh lama rasa nya x update blog.. aku tengah2 blogwalking terjumpa la satu picture nie... memang lawak la kalau korang dengar..klau sebelum nie kita biasa dengar orang berpenrangai GEDIK ( atau lebih familiar dikalangan kita mengada-ngada) 

tapi nie sekarang ada pulak ayam gedik..hahah kalu korang x percaya korang tengok kat picture bawah nie.
.
.
.
.
korang jangan salah sangka ni jenama je.. haha mane ada kot ayam gedik... tak silap aku nie mungkin dekat perancis... siapa yang nak gedik beli lah ayam nie....hahaha